Insertion by sillitoe on 06 Mar 2006 15:53
HomCheck 'New T' domains
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1h54A01 | 1 | 269 |
| 1h54A02 | 317 | 683 |
| 1h54A03 | 310 | 314 |
| 1h54A03 | 685 | 753 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1h54A03 VVIKGGFAGMRVRDGQLHYAPFLPKTWTSYTFRQVFRDRLIEVSVHADGPHFKLLSGEPLTIDVAGAAAAAAAA
HomCheck 'New T' domains
HomCheck 'New T' domains
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"