Set cath from cathlist by auto on 05 Mar 2006 18:50
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1h4rA01 | 21 | 98 |
| 1h4rA02 | 99 | 215 |
| 1h4rA03 | 217 | 307 |
There are 49 matching structural neighberhood comparisons for CATH ID 3.10.20.90.6.1.1.1.1 (SIMAX score < 5)
>pdb|1h4rA01 TFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLA
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"