CATH Domain: 1h3nA04 XML data for domain: 1h3nA04

Molscript image for 1h3nA04
1h3nA04
PDB coordinates for domain 1h3nA04

PDB 1h3n, Chain A, Domain 4

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.730 Isoleucyl-tRNA Synthetase; Domain 1
1.10.730.10 Isoleucyl-tRNA Synthetase; Domain 1 Gene3D
1.10.730.10.3
1.10.730.10.3.1
1.10.730.10.3.1.1
1.10.730.10.3.1.1.1
1.10.730.10.3.1.1.1.1

[top]
Segment boundaries for domain 1h3nA04

Chopping figure for domain 1h3nA04
DomainStart PDB ResidueStop PDB Residue
1h3nA01 31 222
1h3nA01 417 578
1h3nA01 636 646
1h3nA02 227 416
1h3nA03 579 635
1h3nA04 655 813

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 1.10.730.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1wkbA03 83.06 Leucyl-tRNA synthetase [EC:6.1.1.4]Aminoacyl-tRNA biosynthesisPyrococcus horikoshiiLeucyl-tRNA synthetaseValine, leucine and isoleucine biosynthesis 1.10.730.10 121 23 69 2.53 3.62
1gaxA02 82.71 Aminoacyl-tRNA biosynthesisValyl-tRNA synthetase [EC:6.1.1.9]Valyl-tRNA synthetaseValine, leucine and isoleucine biosynthesisThermus thermophilus 1.10.730.10 227 19 69 3.09 4.47
1ileA03 82.57 Aminoacyl-tRNA biosynthesisThermus thermophilus HB8Isoleucyl-tRNA synthetase [EC:6.1.1.5]Isoleucyl-tRNA synthetaseValine, leucine and isoleucine biosynthesis 1.10.730.10 191 19 71 2.13 2.97
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1h3nA04
QGADIARITILFAAPPENEMVWTEEGVQGAWRFLNRIYRRVAEDREALLETSGVFQAEALEGKDRELYGKLHETLKKVTE
DLEALRFNTAIAALMEFLNALYEYRKDRPVTPVYRTAIRYYLQMLFPFAPHLAEELWHWFWPDSLFEAGWPELDEKALE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1h3nA04
QGADIARITILFAAPPENEMVWTEEGVQGAWRFLNRIYRRVAEDREALLETSGVFQAEALEGKDRELYGKLHETLKKVTE
DLEALRFNTAIAALMEFLNALYEYRKDRPVTPVYRTAIRYYLQMLFPFAPHLAEELWHWFWPDSLFEAGWPELDEKALE
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:15

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:15

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:43

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"