CATH Domain: 1h3nA02 XML data for domain: 1h3nA02

Molscript image for 1h3nA02
1h3nA02
PDB coordinates for domain 1h3nA02

PDB 1h3n, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.740 Isoleucyl-tRNA Synthetase; domain 2
3.90.740.10 Isoleucyl-tRNA Synthetase; Domain 2 Gene3D
3.90.740.10.2
3.90.740.10.2.2
3.90.740.10.2.2.1
3.90.740.10.2.2.1.1
3.90.740.10.2.2.1.1.1

[top]
Segment boundaries for domain 1h3nA02

Chopping figure for domain 1h3nA02
DomainStart PDB ResidueStop PDB Residue
1h3nA01 31 222
1h3nA01 417 578
1h3nA01 636 646
1h3nA02 227 416
1h3nA03 579 635
1h3nA04 655 813

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.90.740.10.2.2.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1wkaA00 83.74 Aminoacyl-tRNA biosynthesisValyl-tRNA synthetase [EC:6.1.1.9]Valyl-tRNA synthetaseValine, leucine and isoleucine biosynthesisThermus thermophilus 3.90.740.10 143 25 73 1.82 2.47
1wkbA02 78.24 Leucyl-tRNA synthetase [EC:6.1.1.4]Aminoacyl-tRNA biosynthesisPyrococcus horikoshiiLeucyl-tRNA synthetaseValine, leucine and isoleucine biosynthesis 3.90.740.10 227 17 65 2.71 4.16
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1h3nA02
SEGAEILFPVEGKEVRIPVFTTRPDTLFGATFLVLAPEHPLTLELAAPEKREEVLAYVEAAKRKTEIERQAEGREKTGVF
LGAYALNPATGERIPIWTADYVLFGYGTGAIMAVPAHDQRDYEFARKFGLPIKKVIERPGEPLPEPLERAYEEPGIMVNS
GPFDGTESEEGKRKVIAWLEEKGLGKGRVT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1h3nA02
SEGAEILFPVEGKEVRIPVFTTRPDTLFGATFLVLAPEHPLTLELAAPEKREEVLAYVEAAKRKTEIERQAEGREKTGVF
LGAYALNPATGERIPIWTADYVLFGYGTGAIMAVPAHDQRDYEFARKFGLPIKKVIERPGEPLPEPLERAYEEPGIMVNS
GPFDGTESEEGKRKVIAWLEEKGLGKGRVT
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:36

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:36

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:43

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"