Domain assigned by auto on 28 Apr 2006 18:10
Assigning to "3.40.50.620" based on similarity with "1h3fA01" (NWSI: 100, NWO: 100, SPS: 97.63, SPO: 96, RMSD: 0.38)
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1h3fB01 | 8 | 223 |
| 1h3fB02 | 224 | 340 |
| 1h3fB03 | 353 | 431 |
There are 7 matching structural neighberhood comparisons for CATH ID 3.40.50.620.9.1.1.1.1 (SIMAX score < 5)
>pdb|1h3fB01 PEEALALLKRGAEEIVPEEELLAKLKEGRPLTVKLGADPTRPDLHLGHAVVLRKMRQFQELGHKVVLIIGDFTGMITLEE TRENAKTYVAQAGKILRQEPHLFELRYNSEWLEGLTFKEVVRLTSLMTVAQMLEREDFKKRYEAGIPISLHELLYPFAQA YDSVAIRADVEMGGTDQRFNLLVGREVQRAYGQSPQVCFLMPL
Assigning to "3.40.50.620" based on similarity with "1h3fA01" (NWSI: 100, NWO: 100, SPS: 97.63, SPO: 96, RMSD: 0.38)
NW result present for Domain "1h3fB01"
All required files are present for Domain "1h3fB01"
Beginning processing for Domain "1h3fB01"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"