Domain assigned by auto on 28 Apr 2006 18:10
Assigning to "3.90.180.10" based on similarity with "1h2bA01" (NWSI: 100, NWO: 92.6940639269406, SPS: 98.42, SPO: 99, RMSD: 0.34)
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1h2bB01 | 16 | 168 |
| 1h2bB01 | 309 | 359 |
| 1h2bB02 | 169 | 308 |
There are 14 matching structural neighberhood comparisons for CATH ID 3.90.180.10.3.1.1.1.1 (SIMAX score < 5)
>pdb|1h2bB01 LKAARLHEYNKPLRIEDVDYPRLEGRFDVIVRIAGAGVCHTDLHLVQGMWHELLQPKLPYTLGHENVGYIEEVAEGVEGL EKGDPVILHPAVTDGTCLACRAGEDMHCENLEFPGLNIDGGFAEFMRTSHRSVIKLPKDISREKLVEMAPLADVGNYVEL HELVTLALQGKVRVEVDIHKLDEINDVLERLEKGEVLGRAVLIP
Assigning to "3.90.180.10" based on similarity with "1h2bA01" (NWSI: 100, NWO: 92.6940639269406, SPS: 98.42, SPO: 99, RMSD: 0.34)
NW result present for Domain "1h2bB01"
All required files are present for Domain "1h2bB01"
Beginning processing for Domain "1h2bB01"