Domain assigned by lewis on 09 Aug 2006 17:12
Automatically fixing a bunch of choppings that have domains with misordered segments. Here the domain is being reassigned back to its original superfamily. This work is done under ticket:98.
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1h1lD01 | 68 | 208 |
| 1h1lD02 | 210 | 312 |
| 1h1lD02 | 474 | 480 |
| 1h1lD03 | 47 | 66 |
| 1h1lD03 | 361 | 473 |
| 1h1lD04 | 317 | 360 |
| 1h1lD04 | 481 | 519 |
There are 2 matching structural neighberhood comparisons for CATH ID 3.40.50.1980.8.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1mioB04 | 85.52 | 3.40.50.1980 | 98 | 32 | 73 | 1.34 | 1.82 | |
![]() |
1z0sA01 | 73.50 | 3.40.50.10330 | 123 | 6 | 54 | 2.55 | 4.71 |
>pdb|1h1lD03 TAEYEALNFRREALTVDPAKKKFGLYGDPDFVMGLTRFLLELGCEPTVILSHNANKRWQKAMNKMLDASPYGRDSEVFIN CDLWHFRSLMFTRQPDFMIGNSYGKFIQRDTLAKGKAFEVPLIRLGFPLFDRH
Automatically fixing a bunch of choppings that have domains with misordered segments. Here the domain is being reassigned back to its original superfamily. This work is done under ticket:98.
Automatically fixing a bunch of choppings that have domains with misordered segments. Here the chopping is being reinserted but with the segments reordered in the domains. The domains should not be reordered. This work is done under ticket:98.