CATH Domain: 1gy6A00 XML data for domain: 1gy6A00

Molscript image for 1gy6A00
1gy6A00
PDB coordinates for domain 1gy6A00

PDB 1gy6, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.450 Nuclear Transport Factor 2; Chain: A,
3.10.450.50 Gene3D
3.10.450.50.13
3.10.450.50.13.1
3.10.450.50.13.1.1
3.10.450.50.13.1.1.1
3.10.450.50.13.1.1.1.1

[top]
Segment boundaries for domain 1gy6A00

Chopping figure for domain 1gy6A00
DomainStart PDB ResidueStop PDB Residue
1gy6A00 3 127

Structural Neighbourhood (18 entries)

There are 18 matching structural neighberhood comparisons for CATH ID 3.10.450.50.13.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 18 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1jkgA00 89.01 CytoplasmNuclear poreHomo sapiensNTF2-related export protein 1 3.10.450.50 139 22 87 2.10 2.39
1of5B00 86.24 Nuclear poreNuclear RNA export factor complexMRNA transport regulator MTR2Ribosomal large subunit export from nucleusSaccharomyces cerevisiae 3.10.450.50 128 13 93 2.57 2.74
1m98A02 86.13 Arthrospira maximaOrange carotenoid-binding protein 3.10.450.50 128 14 92 4.42 4.75
3cnxA00 85.38 Streptomyces avermitilisPutative uncharacterized protein 3.10.450.50 135 9 88 2.27 2.55
2owpA00 85.29 Burkholderia xenovorans LB400Putative uncharacterized protein 3.10.450.50 124 7 93 2.87 3.07
3bb9B00 85.18 Putative orphan proteinShewanella frigidimarina NCIMB 400 3.10.450.50 120 6 92 3.15 3.39
1tuhA00 84.88 Uncultured bacteriumPutative uncharacterized protein 3.10.450.50 131 9 87 2.87 3.30
1of5A00 84.22 Nuclear poreStructural constituent of nuclear poreRNA bindingMRNA export factor MEX67MRNA export from nucleus 3.10.450.50 154 17 79 3.86 4.83
2ux0B00 83.91 Calcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiensCalcium- and calmodulin-dependent protein kinase complex 3.10.450.50 136 7 87 2.67 3.05
2rgqB00 83.58 3.10.450.50 124 9 93 3.44 3.68
3b7cA00 83.46 Shewanella oneidensisPutative uncharacterized protein 3.10.450.50 115 10 88 2.57 2.92
2r4iA00 83.43 Cytophaga hutchinsonii ATCC 33406Putative uncharacterized protein 3.10.450.50 113 10 88 2.90 3.27
3blzA00 83.22 Shewanella baltica OS155Putative uncharacterized protein 3.10.450.50 123 4 93 2.83 3.02
1q40D00 82.00 MRNA export factor MEX67Candida albicans 3.10.450.50 169 16 69 3.14 4.54
1q42A00 81.27 MRNA transport regulator MTR2Candida albicans 3.10.450.50 159 13 77 3.07 3.97
1jkgB00 81.08 Nuclear RNA export factor 1Homo sapiensProtein binding 3.10.450.50 180 20 68 2.92 4.27
3cu3A00 80.80 Domain of unknown function with a cystatin-like foldNostoc punctiforme PCC 73102 3.10.450.50 160 8 75 2.78 3.71
1vqqB01 76.90 Staphylococcus aureusPenicillin binding protein 2' 3.10.450.100 103 9 80 3.85 4.81
[1]
Displaying entries 1 to 18 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1gy6A00
DKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCII
SMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1gy6A00
MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSC
IISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:53

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:53

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:17

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"