CATH Domain: 1gupA02 XML data for domain: 1gupA02

Molscript image for 1gupA02
1gupA02
PDB coordinates for domain 1gupA02

PDB 1gup, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.428 HIT family, subunit A
3.30.428.10 HIT family, subunit A Gene3D
3.30.428.10.2
3.30.428.10.2.1
3.30.428.10.2.1.1
3.30.428.10.2.1.1.1
3.30.428.10.2.1.1.1.1

[top]
Segment boundaries for domain 1gupA02

Chopping figure for domain 1gupA02
DomainStart PDB ResidueStop PDB Residue
1gupA01 176 347
1gupA02 44 175

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.428.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1y23B01 81.46 Bacillus subtilisProtein hitHit-like protein involved in cell-cycle regulation 3.30.428.10 112 10 78 3.27 4.19
2fitA00 80.59 Purine metabolismNon-small cell lung cancerProtein bindingBis(5'-adenosyl)-triphosphatase activitySmall cell lung cancer 3.30.428.10 128 7 75 3.71 4.90
1kpfA00 78.75 Histidine triad nucleotide-binding protein 1NucleusCytoskeletonHomo sapiensProtein kinase C binding 3.30.428.10 111 10 76 3.46 4.52
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1gupA02
VLPAHDPDCFLCAGNVRVTGDKNPDYTGTYVFTNDFAALMSDTPDAPESHDPLMRCQSARGTSRVICFSPDHSKTLPELS
VAALTEIVKTWQEQTAELGKTYPWVQVFENKGAAMGCSNPHPGGQIWANSFL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1gupA02
VLPAHDPDCFLCAGNVRVTGDKNPDYTGTYVFTNDFAALMSDTPDAPESHDPLMRCQSARGTSRVICFSPDHSKTLPELS
VAALTEIVKTWQEQTAELGKTYPWVQVFENKGAAMGCSNPHPGGQIWANSFL
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:41

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"