CATH Domain: 1gu9C00 XML data for domain: 1gu9C00

Molscript image for 1gu9C00
1gu9C00
PDB coordinates for domain 1gu9C00

PDB 1gu9, Chain C, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1290 AhpD-like
1.20.1290.10 AhpD-like Gene3D
1.20.1290.10.7
1.20.1290.10.7.1
1.20.1290.10.7.1.1
1.20.1290.10.7.1.1.1
1.20.1290.10.7.1.1.1.1

[top]
Segment boundaries for domain 1gu9C00

Chopping figure for domain 1gu9C00
DomainStart PDB ResidueStop PDB Residue
1gu9C00 3 170

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.20.1290.10.7.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2q0tB01 78.18 Putative gamma-carboxymuconolactone decarboxylase subunitBurkholderia xenovorans LB400 1.20.1290.10 244 13 66 2.92 4.37
3beyD00 75.71 Methanothermobacter thermautotrophicus str. Delta HConserved protein 1.20.1290.10 93 15 46 2.22 4.72
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1gu9C00
IEKLKAALPEYAKDIKLNLSSITRSSVLDQEQLWGTLLASAAATRNPQVLADIGAEATDHLSAAARHAALGAAAIGNNVF
YRGRGFLEGRYDDLRPGLRMNIIANPGIPKANFELWSFAVSAINGCSHCLVAHEHTLRTVGVDREAIFEALKAAAIVSGV
AQALAT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1gu9C00
XSIEKLKAALPEYAKDIKLNLSSITRSSVLDQEQLWGTLLASAAATRNPQVLADIGAEATDHLSAAARHAALGAAAIXGX
NNVFYRGRGFLEGRYDDLRPGLRMNIIANPGIPKANFELWSFAVSAINGCSHCLVAHEHTLRTVGVDREAIFEALKAAAI
VSGVAQALATIEALSPS
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 18:05

Assigning to "1.20.1290.10" based on similarity with "1gu9K00" (NWSI: 98.3050847457627, NWO: 100, SPS: 96.44, SPO: 97, RMSD: 0.53)

Flow stage update by auto on 28 Apr 2006 17:49

NW result present for Domain "1gu9C00"

Flow stage update by auto on 28 Apr 2006 17:43

All required files are present for Domain "1gu9C00"

Flow stage update by auto on 27 Apr 2006 17:30

Beginning processing for Domain "1gu9C00"

Insertion by auto on 05 Mar 2006 16:02

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"