Insertion by lewis on 18 Jan 2007 19:15
Rechopping chains just before release v3.1.0 in order to fix missing fragments.
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1gtmA01 | 35 | 180 |
| 1gtmA02 | 181 | 418 |
There are 1 matching structural neighberhood comparisons for CATH ID 3.40.50.720.157.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
3etgD03 | 87.04 | 3.40.50.720 | 293 | 40 | 79 | 1.69 | 2.12 |
>pdb|1gtmA02 GGSLGRIEATARGASYTIREAAKVLGWDTLKGKTIAIQGYGNAGYYLAKIMSEDFGMKVVAVSDSKGGIYNPDGLNADEV LKWKNEHGSVKDFPGATNITNEELLELEVDVLAPAAIEEVITKKNADNIKAKIVAEVANGPVTPEADEILFEKGILQIPD FLCNAGGVTVSYFEWVQNITGYYWTIEEVRERLDKKMTKAFYDVYNIAKEKNIHMRDAAYVVAVQRVYQAMLDRGWVK
Rechopping chains just before release v3.1.0 in order to fix missing fragments.
Reassigning this domain to its previous classification as part of fragment fixing process in preparation for release v3.1.0.