CATH Domain: 1gteA03 XML data for domain: 1gteA03

Molscript image for 1gteA03
1gteA03
PDB coordinates for domain 1gteA03

PDB 1gte, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.50 3-Layer(bba) Sandwich
3.50.50 FAD/NAD(P)-binding domain
3.50.50.60 Gene3D
3.50.50.60.8
3.50.50.60.8.1
3.50.50.60.8.1.1
3.50.50.60.8.1.1.1
3.50.50.60.8.1.1.1.1

Segment boundaries for domain 1gteA03

Chopping figure for domain 1gteA03
DomainStart PDB ResidueStop PDB Residue
1gteA01 2 26
1gteA01 934 1017
1gteA02 27 183
1gteA03 184 287
1gteA03 441 532
1gteA04 288 440
1gteA05 533 844

Structural Neighbourhood (12 entries)

There are 12 matching structural neighberhood comparisons for CATH ID 3.50.50.60.8.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 12 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1fl2A01 85.07 Alkyl hydroperoxide reductase subunit F [EC:1.6.4.-]Alkyl hydroperoxide reductase subunit FProtein bindingEscherichia coli K-12Cytosol 3.50.50.60 186 16 83 2.82 3.37
1trbA01 84.36 Pyrimidine metabolismThioredoxin reductase (NADPH) [EC:1.8.1.9]Thioredoxin reductaseProtein bindingEscherichia coli K-12 3.50.50.60 187 18 83 3.67 4.39
3fbsB01 83.26 Agrobacterium tumefaciens str. C58Oxidoreductase 3.50.50.60 188 14 82 3.00 3.63
2zbwA01 83.21 Pyrimidine metabolismThermus thermophilus HB8Thioredoxin reductase (NADPH) [EC:1.8.1.9]Ferredoxin--NADP reductase 3.50.50.60 208 18 85 3.79 4.43
1xdiA01 81.84 Citrate cycle (TCA cycle)Valine, leucine and isoleucine degradationPyruvate metabolismGlycine, serine and threonine metabolismMetabolic pathways 3.50.50.60 218 15 72 2.81 3.85
1fcdA01 81.68 Allochromatium vinosumSulfide dehydrogenase [flavocytochrome c] flavoprotein chain 3.50.50.60 188 13 83 3.10 3.73
1sezA01 80.21 Nicotiana tabacumProtoporphyrinogen oxidase, mitochondrial 3.50.50.60 177 14 71 3.39 4.75
1ps9A02 79.91 2,4-dienoyl-CoA reductase (NADPH2) [EC:1.3.1.34]Escherichia coli K-122,4-dienoyl-CoA reductase [NADPH] 3.40.50.720 145 15 71 3.09 4.30
2iidA02 79.81 Calloselasma rhodostomaL-amino-acid oxidase 3.50.50.60 148 12 66 3.00 4.49
3kkjA01 79.73 Pseudomonas syringae pv. tomatoAmine oxidase, flavin-containing protein 3.50.50.60 150 15 69 2.82 4.06
3g3eA01 79.36 PeroxisomeArginine and proline metabolismD-amino-acid oxidase [EC:1.4.3.3]Glycine, serine and threonine metabolismD-amino-acid oxidase activity 3.40.50.720 199 8 75 3.65 4.84
2i0zA01 77.73 NAD(FAD)-utilizing dehydrogenasesBacillus cereus ATCC 14579 3.50.50.60 260 14 63 3.13 4.93
Displaying entries 1 to 12 (page 1 of 1)


Domain ATOM Sequence

>pdb|1gteA03
EAYSAKIALLGAGPASISCASFLARLGYSDITIFEKQEYVGGLSTSEIPQFRLPYDVVNFEIELMKDLGVKIICGKSLSE
NEITLNTLKEEGYKAAFIGIGLPEVLRDPKVKEALSPIKFNRWDLPEVDPETMQTSEPWVFAGGDIVGMANTTVESVNDG
KQASWYIHKYIQAQYGASVSAKPELPLFYTPVDLVD    

Domain COMBS Sequence

>pdb|1gteA03
EAYSAKIALLGAGPASISCASFLARLGYSDITIFEKQEYVGGLSTSEIPQFRLPYDVVNFEIELMKDLGVKIICGKSLSE
NEITLNTLKEEGYKAAFIGIGLPEVLRDPKVKEALSPIKFNRWDLPEVDPETMQTSEPWVFAGGDIVGMANTTVESVNDG
KQASWYIHKYIQAQYGASVSAKPELPLFYTPVDLVD    

Domain History Events (23)

Domain move by cuff on 12 Nov 2010 19:49

COMMENT: move 1gteA03 to 3.50.50.60. same superfamily in SCOP, great SSAP. Structure poorly resolved but a fold match for the 3.50.50.60 superfamily. there are other 3.40.50.720 that could in theory be moved, but not convinced of architecture match. move only 1gteA03 FINAL: move 1gteA03 --> 3.50.50.60

Domain assigned by lewis on 09 Jan 2007 13:16

Assigning domain 1gteA03 to 3.40.50.720 (as agreed with the CATH update team) after the chain has been rechopped. The reason is that the domain is very similar to the old domain 1gteA03 (from the previous chopping at "Sun Mar 5 16:41:08 2006") which was in 3.40.50.720 at the time the chain was unchopped.

Update comment by auto on 09 Jan 2007 11:44

Domain "1gteA03" hits Domain "1h7wD03" (100% over 100%) which is currently in process

Update comment by auto on 09 Jan 2007 07:38

Domain "1gteA03" hits Domain "1h7wD03" (100% over 100%) which is currently in process

Update comment by auto on 09 Jan 2007 03:39

Domain "1gteA03" hits Domain "1h7wD03" (100% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 23:42

Domain "1gteA03" hits Domain "1h7wD03" (100% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 20:17

Domain "1gteA03" hits Domain "1h7wD03" (100% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 15:37

Domain "1gteA03" hits Domain "1h7wD03" (100% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 11:39

Domain "1gteA03" hits Domain "1h7wD03" (100% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 07:33

Domain "1gteA03" hits Domain "1h7wD03" (100% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 03:33

Domain "1gteA03" hits Domain "1h7wD03" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 23:26

Domain "1gteA03" hits Domain "1h7wD03" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 19:31

Domain "1gteA03" hits Domain "1h7wD03" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 15:43

Domain "1gteA03" hits Domain "1h7wD03" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 11:44

Domain "1gteA03" hits Domain "1h7wD03" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 07:35

Domain "1gteA03" hits Domain "1h7wD03" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 03:47

Domain "1gteA03" hits Domain "1h7wD03" (100% over 100%) which is currently in process

Update comment by auto on 06 Jan 2007 23:41

Domain "1gteA03" hits Domain "1h7wD03" (100% over 100%) which is currently in process

Flow stage update by auto on 06 Jan 2007 23:40

Domain "1gteA03" hits Domain "1h7wD03" (100% over 100%) which is currently in process

Flow stage update by auto on 06 Jan 2007 23:40

NW result present for Domain "1gteA03"

Flow stage update by auto on 22 Dec 2006 19:34

All required files are present for Domain "1gteA03"

Flow stage update by auto on 21 Dec 2006 23:35

Beginning processing for Domain "1gteA03"

Insertion by auto on 21 Dec 2006 23:23

Final ChopClose added based on similarity with "1gt8A"