CATH Domain: 1gsoA03 XML data for domain: 1gsoA03

Molscript image for 1gsoA03
1gsoA03
PDB coordinates for domain 1gsoA03

PDB 1gso, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.470 D-amino Acid Aminotransferase; Chain A, domain 1
3.30.470.20 ATP-grasp fold, B domain Gene3D
3.30.470.20.4
3.30.470.20.4.1
3.30.470.20.4.1.1
3.30.470.20.4.1.1.1
3.30.470.20.4.1.1.1.1

[top]
Segment boundaries for domain 1gsoA03

Chopping figure for domain 1gsoA03
DomainStart PDB ResidueStop PDB Residue
1gsoA01 2 95
1gsoA02 121 190
1gsoA03 191 329
1gsoA04 330 425

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.470.20.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1vkzA03 89.01 Thermotoga maritimaPhosphoribosylamine--glycine ligase [EC:6.3.4.13]Purine metabolismPhosphoribosylamine--glycine ligaseMetabolic pathways 3.30.470.20 129 33 92 1.70 1.83
2pn1A03 77.61 Pyrimidine metabolismExiguobacterium sibiricum 255-15Alanine, aspartate and glutamate metabolismCarbamoyl-phosphate synthase large subunit [EC:6.3.5.5]Metabolic pathways 3.30.470.20 116 14 79 3.53 4.46
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1gsoA03
DGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVTDDVHQRTMERIIWPTVKGMAAEGNTYTGFL
YAGLMIDKQGNPKVIEFNCRFGDLETQPIMLRMKSDLVELCLAACESKLDEKTSEWDER
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1gsoA03
DGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVTDDVHQRTMERIIWPTVKGMAAEGNTYTGFL
YAGLMIDKQGNPKVIEFNCRFGDLETQPIMLRMKSDLVELCLAACESKLDEKTSEWDER
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:06

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:06

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:40

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"