CATH Domain: 1gsaA03 XML data for domain: 1gsaA03

Molscript image for 1gsaA03
1gsaA03
PDB coordinates for domain 1gsaA03

PDB 1gsa, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1490 Dna Ligase; domain 1
3.30.1490.20 ATP-grasp fold, A domain Gene3D
3.30.1490.20.9
3.30.1490.20.9.1
3.30.1490.20.9.1.1
3.30.1490.20.9.1.1.1
3.30.1490.20.9.1.1.1.1

[top]
Segment boundaries for domain 1gsaA03

Chopping figure for domain 1gsaA03
DomainStart PDB ResidueStop PDB Residue
1gsaA01 1 114
1gsaA01 301 314
1gsaA02 115 136
1gsaA02 202 300
1gsaA03 137 201

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 3.30.1490.20.9.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ehiA03 86.20 D-Alanine metabolismD-Ala-D-Ala ligase2Peptidoglycan biosynthesisD-alanine-D-alanine ligase [EC:6.3.2.4]Leuconostoc mesenteroides 3.30.1490.20 68 7 91 2.73 2.99
1i7nA01 85.75 Rattus norvegicusRegulation of neurotransmitter secretionSynapsin-2Cytoskeletal protein binding 3.30.1490.20 60 15 92 2.38 2.58
1vkzA02 85.23 Thermotoga maritimaPhosphoribosylamine--glycine ligase [EC:6.3.4.13]Purine metabolismPhosphoribosylamine--glycine ligaseMetabolic pathways 3.30.1490.20 70 12 91 2.96 3.24
2nu8B02 81.32 Citrate cycle (TCA cycle)Propanoate metabolismMetabolic pathwaysC5-Branched dibasic acid metabolismTricarboxylic acid cycle 3.30.1490.20 84 10 76 3.30 4.33
2r85A03 80.05 Pyrococcus furiosus5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase [EC:6.3.4.-]Purine metabolism5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetaseMetabolic pathways 3.30.1490.20 58 18 80 2.90 3.62
1m0wB05 79.33 Glutathione synthase [EC:6.3.2.3]Glutathione bindingProtein homodimerization activityGlutathione metabolismMetabolic pathways 3.30.1490.50 60 10 86 3.65 4.24
2r6fA03 78.60 Nucleotide excision repairGeobacillus kaustophilusExcinuclease ABC subunit AExcinuclease ABC subunit A 3.30.1490.20 70 7 81 3.20 3.93
3kalA05 77.99 Homoglutathione synthetaseGlycine max 3.30.1490.50 61 13 87 3.74 4.26
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1gsaA03
ETLVTRNKAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNLGVIAETLTEHGTRYCMAQNYL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1gsaA03
ETLVTRNKAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNLGVIAETLTEHGTRYCMAQNYL
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1gsa003" to "1gsaA03" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 19:10

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:10

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:40

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"