CATH Domain: 1gsaA02 XML data for domain: 1gsaA02

Molscript image for 1gsaA02
1gsaA02
PDB coordinates for domain 1gsaA02

PDB 1gsa, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.470 D-amino Acid Aminotransferase; Chain A, domain 1
3.30.470.20 ATP-grasp fold, B domain Gene3D
3.30.470.20.14
3.30.470.20.14.1
3.30.470.20.14.1.1
3.30.470.20.14.1.1.1
3.30.470.20.14.1.1.1.1

[top]
Segment boundaries for domain 1gsaA02

Chopping figure for domain 1gsaA02
DomainStart PDB ResidueStop PDB Residue
1gsaA01 1 114
1gsaA01 301 314
1gsaA02 115 136
1gsaA02 202 300
1gsaA03 137 201

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.470.20.14.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2pn1A03 78.22 Pyrimidine metabolismExiguobacterium sibiricum 255-15Alanine, aspartate and glutamate metabolismCarbamoyl-phosphate synthase large subunit [EC:6.3.5.5]Metabolic pathways 3.30.470.20 116 6 69 3.22 4.64
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1gsaA02
KPQSLRDCNEKLFTAWFSDLTPPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGGRGEPRPLTESDWKIARQIG
PTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1gsaA02
KPQSLRDCNEKLFTAWFSDLTPPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGGRGEPRPLTESDWKIARQIG
PTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1gsa002" to "1gsaA02" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 19:06

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:06

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:40

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"