CATH Domain: 1gqiA01 XML data for domain: 1gqiA01

Molscript image for 1gqiA01
1gqiA01
PDB coordinates for domain 1gqiA01

PDB 1gqi, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.379 Chitobiase; domain 2
3.30.379.10 Chitobiase, domain 2 Gene3D
3.30.379.10.1
3.30.379.10.1.1
3.30.379.10.1.1.1
3.30.379.10.1.1.1.1
3.30.379.10.1.1.1.1.1

[top]
Segment boundaries for domain 1gqiA01

Chopping figure for domain 1gqiA01
DomainStart PDB ResidueStop PDB Residue
1gqiA01 18 148
1gqiA02 153 472
1gqiA03 476 712

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.379.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1l8nA01 88.54 Geobacillus stearothermophilusAlpha-glucuronidase 3.30.379.10 123 26 90 1.87 2.06
1jakA02 80.63 B-N-acetylhexosaminidaseStreptomyces plicatus 3.30.379.10 141 12 78 3.63 4.65
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1gqiA01
ADQTLLKTYQKQIRHLHVAGDSPTINAAAAELQRGLSGLLNKPIVARDEKLKDYSLVIGTPDNSPLIASLNLGERLQALG
AEGYLLEQTRINKRHVVIVAANSDVGVLYGSFHLLRLIQTQHALEKLSLSS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1gqiA01
ADQTLLKTYQKQIRHLHVAGDSPTINAAAAELQRGLSGLLNKPIVARDEKLKDYSLVIGTPDNSPLIASLNLGERLQALG
AEGYLLEQTRINKRHVVIVAANSDVGVLYGSFHLLRLIQTQHALEKLSLSS
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 18:03

Assigning to "3.30.379.10" based on similarity with "1gqiB01" (NWSI: 100, NWO: 100, SPS: 99.09, SPO: 100, RMSD: 0.23)

Flow stage update by auto on 28 Apr 2006 17:49

NW result present for Domain "1gqiA01"

Flow stage update by auto on 28 Apr 2006 17:43

All required files are present for Domain "1gqiA01"

Flow stage update by auto on 27 Apr 2006 17:30

Beginning processing for Domain "1gqiA01"

Insertion by auto on 08 Mar 2006 18:46

Final ChopClose added based on similarity with "1gqiB" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 98.80, SI: 100, SO: 100]