CATH Domain: 1gpeA02 XML data for domain: 1gpeA02

Molscript image for 1gpeA02
1gpeA02
PDB coordinates for domain 1gpeA02

PDB 1gpe, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.450 Glucose Oxidase; domain 2
4.10.450.10 Glucose Oxidase, domain 2 Gene3D
4.10.450.10.1
4.10.450.10.1.1
4.10.450.10.1.1.1
4.10.450.10.1.1.1.1
4.10.450.10.1.1.1.1.1

[top]
Segment boundaries for domain 1gpeA02

Chopping figure for domain 1gpeA02
DomainStart PDB ResidueStop PDB Residue
1gpeA01 8 57
1gpeA01 240 328
1gpeA01 439 455
1gpeA01 523 557
1gpeA01 575 587
1gpeA02 58 86
1gpeA02 97 113
1gpeA02 222 239
1gpeA03 114 221
1gpeA03 329 438
1gpeA03 456 522
1gpeA03 558 574

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1gpeA02
FYESNDGAIIEDPNAYGQIFGTTVDQNYLNIKAGKGLGGSTLINGDNLDENQVRVDAARAWLLP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1gpeA02
FYESNDGAIIEDPNAYGQIFGTTVDQNYLNIKAGKGLGGSTLINGDNLDENQVRVDAARAWLLP
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:38

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:38

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:40

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"