Set cath from cathlist by auto on 05 Mar 2006 18:31
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1go3E01 | 82 | 182 |
| 1go3E02 | 1 | 81 |
There are 23 matching structural neighberhood comparisons for CATH ID 2.40.50.140.8.1.1.1.1 (SIMAX score < 5)
>pdb|1go3E01 YELIEGEVVDVVEFGSFVRLGPLDGLIHVSQIMDDYVSYDPKAIIGKETGKVLEIGDYVRARIVAISLKASKIALTMRQP YLGKLEWIEEEKAK
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"