CATH Domain: 1gnwA02 XML data for domain: 1gnwA02

Molscript image for 1gnwA02
1gnwA02
PDB coordinates for domain 1gnwA02

PDB 1gnw, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1050 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2
1.20.1050.10 Gene3D
1.20.1050.10.24
1.20.1050.10.24.1
1.20.1050.10.24.1.1
1.20.1050.10.24.1.1.1
1.20.1050.10.24.1.1.1.1

[top]
Segment boundaries for domain 1gnwA02

Chopping figure for domain 1gnwA02
DomainStart PDB ResidueStop PDB Residue
1gnwA01 2 86
1gnwA02 87 211

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 1.20.1050.10.24.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1hqoA02 86.52 Soluble fractionCytosolProtein URE2Cytoplasmic sequestering of transcription factorProtein urmylation 1.20.1050.10 126 18 90 2.80 3.09
1nhyA02 85.27 Positive regulation of transcription from RNA polymerase II promoterCalcium ion bindingNucleusElongation factor 1-gamma 1Transcription coactivator activity 1.20.1050.10 139 14 86 2.60 3.01
1gwcA02 82.73 Aegilops tauschiiGlutathione S-transferase 1 1.20.1050.10 141 15 81 2.83 3.47
2c3nA02 81.87 Soluble fractionGlutathione S-transferase theta-1Glutathione metabolic processGlutathione transferase activityGlutathione metabolism 1.20.1050.10 160 15 77 2.34 3.02
3cbuA02 80.38 Glutathione S-transferase [EC:2.5.1.18]Ralstonia eutropha JMP134Metabolism of xenobiotics by cytochrome P450Probable gst-related proteinGlutathione metabolism 1.20.1050.10 132 19 84 3.22 3.79
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1gnwA02
QTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFT
LTDLHHIPAIQYLLGTPTKKLFTERPRVNEWVAEITKRPASEKVQ
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1gnwA02
QTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFT
LTDLHHIPAIQYLLGTPTKKLFTERPRVNEWVAEITKRPASEKVQ
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:40

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"