Domain assigned by auto on 22 Aug 2007 22:16
Assigning to "1.10.290.10" based on similarity with "1cy0A04"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1gkuB01 | 1 | 20 |
| 1gkuB01 | 556 | 582 |
| 1gkuB02 | 33 | 245 |
| 1gkuB03 | 246 | 352 |
| 1gkuB03 | 426 | 504 |
| 1gkuB04 | 353 | 425 |
| 1gkuB05 | 505 | 555 |
| 1gkuB05 | 608 | 677 |
| 1gkuB06 | 678 | 732 |
| 1gkuB06 | 954 | 1054 |
| 1gkuB07 | 733 | 771 |
| 1gkuB07 | 891 | 953 |
| 1gkuB08 | 772 | 890 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1gkuB08 PPYTTETMLSDANRILKFSVKQTMQIAQELFENGLITYHRTDSTRVSDVGQRIAKEYLGDDFVGREWGESGAHECIRPTR PLTRDDVQRLIQEGVLVVEGLRWEHFALYDLIFRRFMAS
Assigning to "1.10.290.10" based on similarity with "1cy0A04"
No in_process hits for Domain "1gkuB08" ready to be processed
NW result present for Domain "1gkuB08"
All required files are present for Domain "1gkuB08"
Beginning processing for Domain "1gkuB08"
nice chopping