CATH Domain: 1gkrA01 XML data for domain: 1gkrA01

Molscript image for 1gkrA01
1gkrA01
PDB coordinates for domain 1gkrA01

PDB 1gkr, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.30 Roll
2.30.40 Urease, subunit C; domain 1
2.30.40.10 Urease, subunit C, domain 1 Gene3D
2.30.40.10.23
2.30.40.10.23.1
2.30.40.10.23.1.1
2.30.40.10.23.1.1.1
2.30.40.10.23.1.1.1.1

[top]
Segment boundaries for domain 1gkrA01

Chopping figure for domain 1gkrA01
DomainStart PDB ResidueStop PDB Residue
1gkrA01 1 53
1gkrA01 381 392
1gkrA01 420 441
1gkrA02 54 373
1gkrA02 393 419

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 2.30.40.10.23.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1o12A01 85.83 Amino sugar and nucleotide sugar metabolismThermotoga maritimaN-acetylglucosamine-6-phosphate deacetylaseN-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25] 2.30.40.10 72 23 78 3.31 4.23
1ejxC01 76.41 Arginine and proline metabolismKlebsiella aerogenesPurine metabolismUrease alpha subunit [EC:3.5.1.5]Atrazine degradation 2.30.40.10 185 31 46 1.84 3.96
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1gkrA01
MFDVIVKNCRLVSSDGITEADILVKDGKVAAISADTSDVEASRTIDAGGKFVMLQVGSDADLLILTGAPVLTMVRGTVVA
EKGEVLV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1gkrA01
MFDVIVKNCRLVSSDGITEADILVKDGKVAAISADTSDVEASRTIDAGGKFVMLQVGSDADLLILTGAPVLTMVRGTVVA
EKGEVLV
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 10 Aug 2006 15:16

Assigning to "2.30.40.10" based on similarity with "1gkrC01" (NWSI: 100, NWO: 100, SPS: 99.84, SPO: 100, RMSD: 0.07)

Flow stage update by auto on 10 Aug 2006 15:15

No in_process hits for Domain "1gkrA01" ready to be processed

Flow stage update by auto on 09 Aug 2006 20:50

NW result present for Domain "1gkrA01"

Flow stage update by auto on 09 Aug 2006 20:50

All required files are present for Domain "1gkrA01"

Flow stage update by auto on 09 Aug 2006 20:49

Beginning processing for Domain "1gkrA01"

Insertion by auto on 05 Mar 2006 16:39

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"