CATH Domain: 1gheA00

There are 45 matching structural neighberhood comparisons for CATH ID 3.40.630.30.8.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	2i79D00	86.57	Acetyltransferase, GNAT familyStreptococcus pneumoniae	3.40.630.30	167	9	94	2.37	2.50
	2ge3B00	86.55	Agrobacterium tumefaciens str. C58Probable acetyltransferase	3.40.630.30	159	15	93	2.12	2.26
	3k9uA00	85.62	Putative uncharacterized protein Ta0374Thermoplasma acidophilum	3.40.630.30	159	13	87	2.54	2.89
	3g8wA00	85.36	Staphylococcus epidermidis ATCC 12228Lactococcal prophage ps3 protein 05	3.40.630.30	158	12	91	3.03	3.31
	2r7hB00	85.02	Desulfovibrio desulfuricans subsp. desulfuricans str. G20Putative uncharacterized protein	3.40.630.30	157	17	90	2.65	2.93
	2fiaA00	85.01	Acetyltransferase, GNAT familyEnterococcus faecalis	3.40.630.30	157	16	89	2.98	3.32
	1tiqB00	84.90	Bacillus subtilisProtease synthase and sporulation negative regulatory protein PAI 1	3.40.630.30	161	16	90	3.69	4.08
	1n71B00	84.63	Aac(6')-Ii proteinEnterococcus faecium	3.40.630.30	179	16	82	2.48	3.02
	1vhsB00	84.45	Bacillus subtilisPhosphinothricin acetyltransferase [EC:2.3.1.183]Phosphonate and phosphinate metabolismPutative phosphinothricin acetyltransferase ywnH	3.40.630.30	155	18	89	2.52	2.83
	2fiwA00	83.87	Putative acetyltransferase [EC:2.3.1.-]GCN5-related N-acetyltransferase:Aminotransferase, class-IIRhodopseudomonas palustris	3.40.630.30	156	15	84	2.82	3.34
	3fncA00	83.71	Listeria innocuaLin0611 protein	3.40.630.30	157	17	88	3.24	3.66
	2ae6A00	83.71	Acetyltransferase, GNAT familyEnterococcus faecalis	3.40.630.30	144	13	83	3.06	3.65
	1qsmD00	83.38	CytoplasmIdentical protein bindingSaccharomyces cerevisiaeHistone acetyltransferase activityHistone acetyltransferase HPA2	3.40.630.30	152	13	84	3.57	4.23
	3fb3A00	82.67	Amino sugar and nucleotide sugar metabolismGlucosamine-phosphate N-acetyltransferase [EC:2.3.1.4]N-acetyltransferase, putativeTrypanosoma brucei	3.40.630.30	141	16	80	3.07	3.80
	1yreC00	82.66	Pseudomonas aeruginosaPutative uncharacterized protein	3.40.630.30	182	17	85	2.78	3.24
	1cjwA00	82.55	Ovis ariesSerotonin N-acetyltransferase	3.40.630.30	166	14	87	3.04	3.46
	2i00C01	82.44	Acetyltransferase, GNAT familyEnterococcus faecalis	3.40.630.30	144	9	77	2.95	3.80
	3exnA00	82.41	Tyrosine metabolismLimonene and pinene degradation1- and 2-Methylnaphthalene degradationPhenylalanine metabolismBenzoate degradation via CoA ligation	3.40.630.30	151	14	86	2.79	3.24
	3fbuA00	82.30	Bacillus anthracisAcetyltransferase, GNAT family	3.40.630.30	166	6	90	2.90	3.19
	2fckA00	82.23	Vibrio choleraeRibosomal-protein-serine acetyltransferase, putative	3.40.630.30	171	10	90	3.68	4.09
	2dxqA00	82.03	Agrobacterium tumefaciens str. C58Acetyltransferase	3.40.630.30	145	18	83	3.14	3.78
	1q2yA00	81.74	Bacillus subtilisUncharacterized N-acetyltransferase yjcF	3.40.630.30	140	14	82	3.36	4.07
	1xebA00	81.59	Pseudomonas aeruginosaElaA proteinPutative uncharacterized protein	3.40.630.30	146	20	84	3.13	3.68
	2ozgA01	81.44	Anabaena variabilis ATCC 29413GCN5-related N-acetyltransferase	3.40.630.30	117	12	68	2.21	3.25
	2pdoA01	81.11	Shigella flexneriAcetyltransferase ypeA	3.40.630.30	118	16	69	2.62	3.75
	1y7rA00	81.10	Staphylococcus aureus subsp. aureus Mu50Putative uncharacterized protein	3.40.630.30	125	10	73	3.28	4.46
	3d3sA00	81.05	L-2,4-diaminobutyric acid acetyltransferaseGlycine, serine and threonine metabolismBordetella parapertussisL-2,4-diaminobutyric acid acetyltransferase [EC:2.3.1.178]Metabolic pathways	3.40.630.30	157	13	87	3.15	3.58
	2r1iA01	81.05	Arthrobacter sp. FB24GCN5-related N-acetyltransferase	3.40.630.30	129	20	75	2.68	3.56
	1nslA00	81.04	Bacillus subtilisPutative ribosomal N-acetyltransferase ydaF	3.40.630.30	173	12	90	3.26	3.59
	3efaA00	80.98	Tyrosine metabolismBenzoate degradation via CoA ligationLactobacillus plantarumAcetyltransferase (Putative)Limonene and pinene degradation	3.40.630.30	141	15	81	2.95	3.63
	1y9wA01	80.91	AcetyltransferaseBacillus cereus ATCC 14579	3.40.630.30	104	22	60	1.78	2.93
	1m4iB00	80.81	Aminoglycoside 2'-N-acetyltransferaseMycobacterium tuberculosis	3.40.630.30	176	17	78	3.54	4.51
	2q0yA01	80.75	Ralstonia eutropha JMP134GCN5-related N-acetyltransferase	3.40.630.30	125	20	71	2.77	3.90
	3eo4A00	80.65	Methanocaldococcus jannaschiiUncharacterized protein MJ1062	3.40.630.30	155	10	84	2.91	3.43
	1bo4A00	79.86	Aminoglycoside-(3)-N-acetyltransferaseSerratia marcescens	3.40.630.30	136	12	78	3.52	4.46
	1ro5A01	78.96	Pseudomonas aeruginosaAcyl homoserine lactone synthase [EC:2.3.1.184]Acyl-homoserine-lactone synthase	3.40.630.30	187	10	80	3.42	4.24
	3f5bA00	78.73	Aminoglycoside N(6')acetyltransferaseLegionella pneumophila subsp. pneumophila str. Philadelphia 1	3.40.630.30	163	10	89	4.21	4.72
	2fsrA00	78.40	Agrobacterium tumefaciens str. C58Acetyltranferase	3.40.630.30	168	9	89	4.25	4.76
	3gkrA02	78.25	Weissella viridescensFemX	3.40.630.30	165	6	75	2.94	3.87
	2g3aA02	77.42	Agrobacterium tumefaciens str. C58Acetyltransferase	3.40.630.30	97	22	57	2.36	4.08
	2qmlA00	77.35	BH2621 proteinBacillus halodurans	3.40.630.30	184	9	78	3.63	4.64
	2fl4A02	76.96	Arginine and proline metabolismSpermine/spermidine acetyltransferase, putativeDiamine N-acetyltransferase [EC:2.3.1.57]Metabolic pathwaysEnterococcus faecalis	3.40.630.30	104	13	59	2.93	4.91
	1sqhA02	76.95	Drosophila melanogasterCG14615	3.40.630.30	128	15	66	3.30	4.98
	1kzfA00	76.64	Pantoea stewartii subsp. stewartiiAcyl-homoserine-lactone synthase	3.40.630.30	198	6	64	3.15	4.87
	3dsbA01	75.98	Putative acetyltransferaseClostridium difficile 630	3.40.630.30	96	14	56	2.63	4.69

>pdb|1gheA00
AQLRRVTAESFAHYRHGLAQLLFETVHGGASVGFADLDQQAYAWCDGLKADIAAGSLLLWVVAEDDNVLASAQLSLCQKP
NGLNRAEVQKLVLPSARGRGLGRQLDEVEQVAVKHKRGLLHLDTEAGSVAEAFYSALAYTRVGELPGYCATPDGRLHPTA
IYFKTL    

>pdb|1gheA00
XNHAQLRRVTAESFAHYRHGLAQLLFETVHGGASVGFXADLDXQQAYAWCDGLKADIAAGSLLLWVVAEDDNVLASAQLS
LCQKPNGLNRAEVQKLXVLPSARGRGLGRQLXDEVEQVAVKHKRGLLHLDTEAGSVAEAFYSALAYTRVGELPGYCATPD
GRLHPTAIYFKTLGQPT