CATH Domain: 1gccA00 XML data for domain: 1gccA00

Molscript image for 1gccA00
1gccA00
PDB coordinates for domain 1gccA00

PDB 1gcc, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.730 GCC-box Binding Domain
3.30.730.10 GCC-box Binding Domain Gene3D
3.30.730.10.1
3.30.730.10.1.1
3.30.730.10.1.1.1
3.30.730.10.1.1.1.1
3.30.730.10.1.1.1.1.1

[top]
Segment boundaries for domain 1gccA00

Chopping figure for domain 1gccA00
DomainStart PDB ResidueStop PDB Residue
1gccA00 144 206

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.730.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3bidA01 81.38 Neisseria meningitidis serogroup BUPF0339 protein NMB1088 3.30.160.160 46 10 71 3.15 4.41
1b69A00 78.86 Transposase from transposon Tn916Enterococcus faecalis 3.30.160.60 69 9 68 2.42 3.55
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1gccA00
KHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1gccA00
KHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRV
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:08

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:08

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:31

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"