CATH Domain: 1gaxA04 XML data for domain: 1gaxA04

Molscript image for 1gaxA04
1gaxA04
PDB coordinates for domain 1gaxA04

PDB 1gax, Chain A, Domain 4

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1170 Valyl-trna Synthetase; Chain: A, domain 4
3.30.1170.10 Gene3D
3.30.1170.10.1
3.30.1170.10.1.1
3.30.1170.10.1.1.1
3.30.1170.10.1.1.1.1
3.30.1170.10.1.1.1.1.1

[top]
Segment boundaries for domain 1gaxA04

Chopping figure for domain 1gaxA04
DomainStart PDB ResidueStop PDB Residue
1gaxA01 23 174
1gaxA01 344 529
1gaxA02 1 22
1gaxA02 535 739
1gaxA03 190 342
1gaxA04 740 789
1gaxA05 790 862

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1gaxA04
PAQEVRVYLEGETAPVEENLEVFRFLSRADLLPERPAKALVKAMPRVTAR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1gaxA04
PAQEVRVYLEGETAPVEENLEVFRFLSRADLLPERPAKALVKAMPRVTAR
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:09

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:09

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:37

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"