Set cath from cathlist by auto on 05 Mar 2006 18:15
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1gaxA01 | 23 | 174 |
| 1gaxA01 | 344 | 529 |
| 1gaxA02 | 1 | 22 |
| 1gaxA02 | 535 | 739 |
| 1gaxA03 | 190 | 342 |
| 1gaxA04 | 740 | 789 |
| 1gaxA05 | 790 | 862 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1gaxA02 MDLPKAYDPKSVEPKWAEKWAKNVIDPLEMVERYGADALRFALIYLATGGQDIRLDLRWLEMARNFANKLYNAARFVLLS REGFQAKEDTPTLADRFMRSRLSRGVEEITALYEALDLAQAAREVYELVWSEFCDWYLEAAKPALKAGNAHTLRTLEEVL AVLLKLLHPMMPFLTSELYQALTGKEELALEAWPEPGGRDEEAERAFEALKQAVTAVRALKAEAGLP
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"