CATH Domain: 1g9gA03 XML data for domain: 1g9gA03

Molscript image for 1g9gA03
1g9gA03
PDB coordinates for domain 1g9gA03

PDB 1g9g, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.870 Endo-1,4-beta-glucanase f; domain 3
4.10.870.10 Endo-1,4-beta-glucanase f. Domain 3 Gene3D
4.10.870.10.1
4.10.870.10.1.1
4.10.870.10.1.1.1
4.10.870.10.1.1.1.1
4.10.870.10.1.1.1.1.1

[top]
Segment boundaries for domain 1g9gA03

Chopping figure for domain 1g9gA03
DomainStart PDB ResidueStop PDB Residue
1g9gA01 1 89
1g9gA01 137 152
1g9gA01 227 298
1g9gA01 315 540
1g9gA01 607 628
1g9gA02 90 136
1g9gA02 153 226
1g9gA02 300 314
1g9gA03 541 606

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1g9gA03
VEQRGDYHRFLDQEVFVPAGWTGKMPNGDVIKSGVKFIDIRSKYKQDPEWQTMVAALQAGQVPTQR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1g9gA03
VEQRGDYHRFLDQEVFVPAGWTGKMPNGDVIKSGVKFIDIRSKYKQDPEWQTMVAALQAGQVPTQR
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:39

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:39

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:37

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"