Set cath from cathlist by auto on 05 Mar 2006 18:49
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1g9gA01 | 1 | 89 |
| 1g9gA01 | 137 | 152 |
| 1g9gA01 | 227 | 298 |
| 1g9gA01 | 315 | 540 |
| 1g9gA01 | 607 | 628 |
| 1g9gA02 | 90 | 136 |
| 1g9gA02 | 153 | 226 |
| 1g9gA02 | 300 | 314 |
| 1g9gA03 | 541 | 606 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1g9gA02 PTEKDQPNTSMSRYDANKPATYAPEFQDPSKYPSPLDTSQPVGRDPIHWILDVDNWYGFGARADGTSKPSYINTFQRGEQ ESTWETIPQPCWDEHKFGGQYGFLDLFTKDTGTPAKQFKYTYAWGGGIDSTWSWII
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"