CATH Domain: 1g5hA01 XML data for domain: 1g5hA01

Molscript image for 1g5hA01
1g5hA01
PDB coordinates for domain 1g5hA01

PDB 1g5h, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.930 BirA Bifunctional Protein; domain 2
3.30.930.10 Bira Bifunctional Protein; Domain 2 Gene3D
3.30.930.10.3
3.30.930.10.3.1
3.30.930.10.3.1.1
3.30.930.10.3.1.1.1
3.30.930.10.3.1.1.1.1

[top]
Segment boundaries for domain 1g5hA01

Chopping figure for domain 1g5hA01
DomainStart PDB ResidueStop PDB Residue
1g5hA01 41 353
1g5hA02 354 469

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.30.930.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1atiB01 83.62 Aminoacyl-tRNA biosynthesisThermus thermophilus HB8Glycyl-tRNA synthetase [EC:6.1.1.14]Glycine-tRNA ligase activityProtein dimerization activity 3.30.930.10 305 24 82 3.36 4.08
2zt5A01 82.30 Glycine-tRNA ligase activitySoluble fractionProtein dimerization activityHomo sapiensGlycyl-tRNA synthetase 3.30.930.10 325 17 79 3.54 4.46
3ialA01 80.01 Aminoacyl-tRNA biosynthesisProlyl-tRNA synthetase [EC:6.1.1.15]Giardia lamblia ATCC 50803Prolyl-tRNA synthetase 3.30.930.10 280 8 86 3.86 4.49
1hc7A01 79.89 Aminoacyl-tRNA biosynthesisThermus thermophilus HB8Prolyl-tRNA synthetase [EC:6.1.1.15]Prolyl-tRNA synthetase 3.30.930.10 269 10 85 3.69 4.32
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1g5hA01
EALVDLCRRRHFLSGTPQQLSTAALLSGCHARFGPLGVELRKNLASQWWSSVVFREQVFAVDSLHQEPGSSQPRDSAFRL
VSPESIREILQDSKEQLVAFLENLLKTSGKLRATLLHGALEHYVNCLDLVNRKLPFGLAQIGVCFHPVSTRVGEKTEASL
VWFTPTRTSSQWLDFWLRHRLLWWRKFASPSNFSSADCQDELGRKGSKLYYSFPWGKEPIETLWNLGDQELLHTYPGNVS
TIQGRDGRKNVVPCVLSVSGDVDLGTLAYLYDSFQLRKVLKLHPCLA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1g5hA01
EALVDLCRRRHFLSGTPQQLSTAALLSGCHARFGPLGVELRKNLASQWWSSXVVFREQVFAVDSLHQEPGSSQPRDSAFR
LVSPESIREILQDREPSKEQLVAFLENLLKTSGKLRATLLHGALEHYVNCLDLVNRKLPFGLAQIGVCFHPVSNSNQTPS
SVTRVGEKTEASLVWFTPTRTSSQWLDFWLRHRLLWWRKFAXSPSNFSSADCQDELGRKGSKLYYSFPWGKEPIETLWNL
GDQELLHTYPGNVSTIQGRDGRKNVVPCVLSVSGDVDLGTLAYLYDSFQLAENSFARKKSLQRKVLKLHPCLA
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 20 Jul 2007 15:44

Assigning to "3.30.930.10" based on similarity with "1g5iD01"

Flow stage update by auto on 14 Mar 2007 15:07

No in_process hits for Domain "1g5hA01" ready to be processed

Flow stage update by auto on 14 Mar 2007 15:06

NW result present for Domain "1g5hA01"

Flow stage update by auto on 14 Mar 2007 15:01

All required files are present for Domain "1g5hA01"

Flow stage update by auto on 14 Mar 2007 14:59

Beginning processing for Domain "1g5hA01"

Insertion by auto on 07 Dec 2006 09:17

Final ChopClose added based on similarity with "1g5iA"