CATH Domain: 1g4aE02 XML data for domain: 1g4aE02

Molscript image for 1g4aE02
1g4aE02
PDB coordinates for domain 1g4aE02

PDB 1g4a, Chain E, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.8 Helicase, Ruva Protein; domain 3
1.10.8.10 DNA helicase RuvA subunit, C-terminal domain Gene3D
1.10.8.10.14
1.10.8.10.14.1
1.10.8.10.14.1.1
1.10.8.10.14.1.1.1
1.10.8.10.14.1.1.1.1

[top]
Segment boundaries for domain 1g4aE02

Chopping figure for domain 1g4aE02
DomainStart PDB ResidueStop PDB Residue
1g4aE01 2 109
1g4aE01 244 332
1g4aE02 110 243
1g4aE03 335 442

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 1.10.8.10.14.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1im2A02 80.87 ATP-dependent hsl protease ATP-binding subunit hslUHaemophilus influenzaeATP-dependent HslUV protease ATP-binding subunit HslU 1.10.8.10 40 72 85 2.06 2.42
3h9vA01 75.24 Danio rerioP2X purinoceptor 1.10.287.940 56 2 62 2.92 4.67
1e94E02 72.32 ATP-dependent hsl protease ATP-binding subunit hslUMembraneATP-dependent HslUV protease ATP-binding subunit HslUResponse to heatEscherichia coli K-12 1.10.8.10 98 100 47 1.72 3.59
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1g4aE02
MVRVQAIEKNRYRAEELAEERILDAMKLLIEEEAAKLVNPEELKQDA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1g4aE02
MVRVQAIEKNRYRAEELAEERILDAMKLLIEEEAAKLVNPEELKQDA
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:02

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:02

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:36

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"