Set cath from cathlist by auto on 05 Mar 2006 18:51
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1g1tA01 | 1 | 119 |
| 1g1tA02 | 120 | 157 |
There are 16 matching structural neighberhood comparisons for CATH ID 3.10.100.10.13.1.1.1.1 (SIMAX score < 5)
>pdb|1g1tA01 WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGE PNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYT
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"