CATH Domain: 1fx2A00 XML data for domain: 1fx2A00

Molscript image for 1fx2A00
1fx2A00
PDB coordinates for domain 1fx2A00

PDB 1fx2, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.70 Alpha-Beta Plaits
3.30.70.1230 Adenylyl Cyclase, chain A Gene3D
3.30.70.1230.1
3.30.70.1230.1.1
3.30.70.1230.1.1.1
3.30.70.1230.1.1.1.1
3.30.70.1230.1.1.1.1.1

Segment boundaries for domain 1fx2A00

Chopping figure for domain 1fx2A00
DomainStart PDB ResidueStop PDB Residue
1fx2A00 888 1122

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.70.1230.1.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1azsB00 80.44 Rattus norvegicusCalcium signaling pathwayAdenylate cyclase 2 [EC:4.6.1.1]Purine metabolismAdenylate cyclase type 2 3.30.70.1230 189 17 73 2.73 3.73
Displaying entries 1 to 1 (page 1 of 1)


Domain ATOM Sequence

>pdb|1fx2A00
NNNRAPKEPTDPVTLIFTDIESSTALWAAHPDLMPDAVAAHHRMVRSLIGRYKCYEVKTVGDSFMIASKSPFAAVQLAQE
LQLCFLHHDWGTNALDDSYREFEEQRAEGECEYTPPTAHMDPEVYSRLWNGLRVRVGIHTGLCDIRHDEVTKGYDYYGRT
PNMAARTESVANGGQVLMTHAAYMSLSAEDRKQIDVTALGDVALRGVSDPVKMYQLNTVPSRNFAALRLDREYFD    

Domain COMBS Sequence

>pdb|1fx2A00
NNNRAPKEPTDPVTLIFTDIESSTALWAAHPDLMPDAVAAHHRMVRSLIGRYKCYEVKTVGDSFMIASKSPFAAVQLAQE
LQLCFLHHDWGTNALDDSYREFEEQRAEGECEYTPPTAHMDPEVYSRLWNGLRVRVGIHTGLCDIRHDEVTKGYDYYGRT
PNMAARTESVANGGQVLMTHAAYMSLSAEDRKQIDVTALGDVALRGVSDPVKMYQLNTVPSRNFAALRLDREYFD    

Domain History Events (5)

Classification move by cuff on 26 Apr 2006 17:02

Moving Classification[<3.50.6.10> "Adenylyl Cyclase, chain A" [ACTIVE]] to Classification[<3.30.70.1230> "Adenylyl Cyclase, chain A"]:
Lesley - No, 1w25A03 is an a/b-plait with embellishments so it should not have its architecture changed. Do not merge H-levels without better scores. 1fx2A00 has so much embellishment it has significantly deviated from a core a/b-plait fold that it contains. We can't be sure of ancestry here. But we can merge T-levels. SCOP concurrs. Go to 3.30.70 but new H-level with the name (Adenylyl and guanylyl cyclase catalytic domain). Remember to move only the entire H-level (.10).

Flow stage update by cuff on 26 Apr 2006 17:02

Moving Classification[<3.50.6.10> "Adenylyl Cyclase, chain A" [ACTIVE]] to Classification[<3.30.70.1230> "Adenylyl Cyclase, chain A"]:
Lesley - No, 1w25A03 is an a/b-plait with embellishments so it should not have its architecture changed. Do not merge H-levels without better scores. 1fx2A00 has so much embellishment it has significantly deviated from a core a/b-plait fold that it contains. We can't be sure of ancestry here. But we can merge T-levels. SCOP concurrs. Go to 3.30.70 but new H-level with the name (Adenylyl and guanylyl cyclase catalytic domain). Remember to move only the entire H-level (.10).

Set cath from cathlist by auto on 05 Mar 2006 19:29

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:29

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:53

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"