Set cath from cathlist by auto on 05 Mar 2006 18:43
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1fwxA01 | 10 | 461 |
| 1fwxA02 | 462 | 580 |
There are 10 matching structural neighberhood comparisons for CATH ID 2.60.40.420.18.1.1.1.1 (SIMAX score < 5)
>pdb|1fwxA02 AETRAQAEADGVDIDNWTEEVIRDGNKVRVYMSSVAPSFSIESFTVKEGDEVTVIVTNLDEIDDLTHGFTMGNYGVAMEI GPQMTSSVTFVAANPGVYWYYCQWFCHALHMEMRGRMLVEP
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"