CATH Domain: 1fviA03 XML data for domain: 1fviA03

Molscript image for 1fviA03
1fviA03
PDB coordinates for domain 1fviA03

PDB 1fvi, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.470 D-amino Acid Aminotransferase; Chain A, domain 1
3.30.470.30 DNA ligase/mRNA capping enzyme Gene3D
3.30.470.30.4
3.30.470.30.4.1
3.30.470.30.4.1.1
3.30.470.30.4.1.1.1
3.30.470.30.4.1.1.1.1

[top]
Segment boundaries for domain 1fviA03

Chopping figure for domain 1fviA03
DomainStart PDB ResidueStop PDB Residue
1fviA01 2 29
1fviA01 137 187
1fviA02 188 293
1fviA03 30 136

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.470.30.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1x9nA03 79.09 DNA replicationNucleotide excision repairDNA ligase 1Base excision repairDNA binding 3.30.470.30 126 12 76 2.69 3.53
1a0iA03 77.48 Enterobacteria phage T7DNA ligase 3.30.470.30 148 16 66 3.28 4.90
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1fviA03
GIRSVKQTQMLSRTFKPIRNSVMNRLLTELLPEGSDGEISIEGATFQDTTSAVMTGHAKFSYYWFDYVTDDPLKKYIDRV
EDMKNYITVHPHILEHAQVKIIP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1fviA03
GIRSVKQTQMLSRTFKPIRNSVMNRLLTELLPEGSDGEISIEGATFQDTTSAVMTGHKMYNAKFSYYWFDYVTDDPLKKY
IDRVEDMKNYITVHPHILEHAQVKIIP
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:06

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:06

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:35

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"