CATH Domain: 1fviA01 XML data for domain: 1fviA01

Molscript image for 1fviA01
1fviA01
PDB coordinates for domain 1fviA01

PDB 1fvi, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1490 Dna Ligase; domain 1
3.30.1490.70 Gene3D
3.30.1490.70.4
3.30.1490.70.4.1
3.30.1490.70.4.1.1
3.30.1490.70.4.1.1.1
3.30.1490.70.4.1.1.1.1

[top]
Segment boundaries for domain 1fviA01

Chopping figure for domain 1fviA01
DomainStart PDB ResidueStop PDB Residue
1fviA01 2 29
1fviA01 137 187
1fviA02 188 293
1fviA03 30 136

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.1490.70.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1a0iA01 88.02 Enterobacteria phage T7DNA ligase 3.30.1490.70 83 22 89 1.96 2.20
1x9nA02 84.93 Nucleotide excision repairDNA replicationDNA ligase 1Base excision repairDNA binding 3.30.1490.70 83 13 77 1.84 2.39
1v9pA02 79.70 DNA ligaseThermus filiformis 3.30.1490.70 98 12 69 3.33 4.80
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1fviA01
AITKPLLAATLENIEDVQFPCLATPKIALIPVEINNITELLQYERDVLSKGFEGVMIRKPDGKYKFGRSTLKEGILLKM
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1fviA01
AITKPLLAATLENIEDVQFPCLATPKIALIPVEINNITELLQYERDVLSKGFEGVMIRKPDGKYKFGRSTLKEGILLKM
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:10

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:10

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:35

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"