Set cath from cathlist by auto on 05 Mar 2006 19:08
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
There are 1 matching structural neighberhood comparisons for CATH ID 3.30.1060.10.1.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1nwaA00 | 89.02 | 3.30.1060.10 | 168 | 34 | 80 | 1.94 | 2.41 |
>pdb|1fvgA00 KIVSPQEALPGRKEPLVVAAKHHVNGNRTVEPFPEGTQAVFGGCFWGAERKFWTLKGVYSTQVGFAGGYTPNPTYKEVCS GKTGHAEVVRVVFQPEHISFEELLKVFWENHDPTQGRQGNDHGSQYRSAIYPTSAEHVGAALKSKEDYQKVLSEHGFGLI TTDIREGQTFYYAEDYHQQYLSKDPDGYC
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"