CATH Domain: 1fumA03 XML data for domain: 1fumA03

Molscript image for 1fumA03
1fumA03
PDB coordinates for domain 1fumA03

PDB 1fum, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.58 Methane Monooxygenase Hydroxylase; Chain G, domain 1
1.20.58.100 Gene3D
1.20.58.100.6
1.20.58.100.6.1
1.20.58.100.6.1.1
1.20.58.100.6.1.1.1
1.20.58.100.6.1.1.1.11

[top]
Segment boundaries for domain 1fumA03

Chopping figure for domain 1fumA03
DomainStart PDB ResidueStop PDB Residue
1fumA01 1 235
1fumA01 352 421
1fumA02 236 351
1fumA03 422 541
1fumA04 542 575

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.20.58.100.6.1.1.1.11 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1chuA03 85.68 Nicotinate and nicotinamide metabolismMetabolic pathwaysAlanine, aspartate and glutamate metabolismL-aspartate oxidase activityL-aspartate oxidase [EC:1.4.3.16] 1.20.58.100 88 28 73 3.30 4.50
2jdiH02 70.36 F-type H+-transporting ATPase subunit delta [EC:3.6.3.14]Huntington's diseaseOxidative phosphorylationParkinson's diseaseBos taurus 1.20.5.440 42 2 35 1.47 4.20
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1fumA03
EAAIEAQAAGVEQRLKDLVNQDGGENWAKIRDEMGLAMEEGCGIYRTPELMQKTIDKLAELQERFKRVRITDTSSVFNTD
LLYTIELGHGLNVAECMAHSAMARKESRGAHQRLDEGCTE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1fumA03
EAAIEAQAAGVEQRLKDLVNQDGGENWAKIRDEMGLAMEEGCGIYRTPELMQKTIDKLAELQERFKRVRITDTSSVFNTD
LLYTIELGHGLNVAECMAHSAMARKESRGAHQRLDEGCTE
BLAST against CATH

[top]
Domain History Events (7)

Domain assigned by lewis on 09 Jan 2007 13:16

Assigning domain 1fumA03 to 1.20.58.100 (as agreed with the CATH update team) after the chain has been rechopped. The reason is that the domain is very similar to the old domain 1fumA03 (from the previous chopping at "Sun Mar 5 16:35:15 2006") which was in 1.20.58.100 at the time the chain was unchopped.

Flow stage update by auto on 21 Dec 2006 19:39

No satisfactory AssignClose result found.

Flow stage update by auto on 21 Dec 2006 19:37

No in_process hits for Domain "1fumA03" ready to be processed

Flow stage update by auto on 21 Dec 2006 19:37

NW result present for Domain "1fumA03"

Flow stage update by auto on 18 Dec 2006 15:29

All required files are present for Domain "1fumA03"

Flow stage update by auto on 18 Dec 2006 15:29

Beginning processing for Domain "1fumA03"

Insertion by cuff on 18 Dec 2006 12:39

checked for final chopping