CATH Domain: 1fqjC00 XML data for domain: 1fqjC00

Molscript image for 1fqjC00
1fqjC00
PDB coordinates for domain 1fqjC00

PDB 1fqj, Chain C, Domain 0

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.980 GMP-PDE GAMMA fragment
4.10.980.10 Gene3D
4.10.980.10.1
4.10.980.10.1.1
4.10.980.10.1.1.1
4.10.980.10.1.1.1.1
4.10.980.10.1.1.1.1.1

[top]
Segment boundaries for domain 1fqjC00

Chopping figure for domain 1fqjC00
DomainStart PDB ResidueStop PDB Residue
1fqjC00 50 87

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1fqjC00
FGDDIPGMEGLGTDITVICPWEAFNHLELHELAQYGII
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1fqjC00
GVQGFGDDIPGMEGLGTDITVICPWEAFNHLELHELAQYGII
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:39

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:39

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:02

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"