CATH Domain: 1fo8A02 XML data for domain: 1fo8A02

Molscript image for 1fo8A02
1fo8A02
PDB coordinates for domain 1fo8A02

PDB 1fo8, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.180 2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1
3.10.180.20 N-Acetylglucosaminyltransferase I, Domain 2 Gene3D
3.10.180.20.1
3.10.180.20.1.1
3.10.180.20.1.1.1
3.10.180.20.1.1.1.1
3.10.180.20.1.1.1.1.1

[top]
Segment boundaries for domain 1fo8A02

Chopping figure for domain 1fo8A02
DomainStart PDB ResidueStop PDB Residue
1fo8A01 106 331
1fo8A02 367 446

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1fo8A02
APQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFLFRGRRVHLAPPQTWDGYDPSW
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1fo8A02
APQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFLFRGRRVHLAPPQTWDGYDPSW
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 17:55

Assigning to "3.10.180.20" based on similarity with "1foaA02" (NWSI: 100, NWO: 100, SPS: 98.67, SPO: 98, RMSD: 0.25)

Flow stage update by auto on 28 Apr 2006 17:49

NW result present for Domain "1fo8A02"

Flow stage update by auto on 28 Apr 2006 17:42

All required files are present for Domain "1fo8A02"

Flow stage update by auto on 27 Apr 2006 17:30

Beginning processing for Domain "1fo8A02"

Insertion by auto on 05 Mar 2006 16:33

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"