CATH Domain: 1fnoA01

There are 14 matching structural neighberhood comparisons for CATH ID 3.40.630.10.4.2.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	2qyvA01	82.51	Arginine and proline metabolismGlutathione metabolismHistidine metabolismMetabolic pathwaysXaa-His dipeptidase. Metallo peptidase. MEROPS family M20C	3.40.630.10	250	18	81	2.73	3.35
	1cg2A01	81.75	Pseudomonas sp. RS-16Carboxypeptidase G2	3.40.630.10	279	18	84	2.74	3.26
	2pokA01	80.76	Metabolic pathwaysLysine biosynthesisSuccinyl-diaminopimelate desuccinylase [EC:3.5.1.18]Peptidase, M20/M25/M40 familyStreptococcus pneumoniae	3.40.630.10	288	14	83	2.96	3.56
	1lfwA01	80.55	Lactobacillus delbrueckii subsp. lactisBeta-Ala-Xaa dipeptidase	3.40.630.10	274	14	83	3.03	3.63
	2greA01	79.94	Aminopeptidase [EC:3.4.11.-]Deblocking aminopeptidaseBacillus cereus ATCC 14579	3.40.630.10	233	14	73	2.76	3.77
	1y0yA01	79.52	Endoglucanase [EC:3.2.1.4]Starch and sucrose metabolismPyrococcus horikoshiiTetrahedral aminopeptidase	3.40.630.10	254	16	76	2.72	3.56
	3ct9B01	79.50	Bacteroides thetaiotaomicronAcetylornithine deacetylase	3.40.630.10	233	15	75	3.03	4.01
	1vheA01	79.46	Bacillus subtilisPutative aminopeptidase ysdC	3.40.630.10	268	14	77	3.07	3.95
	1yloA01	79.12	Shigella flexneriPutative uncharacterized protein	3.40.630.10	254	15	73	2.68	3.65
	1vgyA01	79.08	Succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]Neisseria meningitidis serogroup BLysine biosynthesisMetabolic pathwaysSuccinyl-diaminopimelate desuccinylase	3.40.630.10	256	14	79	2.92	3.69
	2cf4A01	78.36	Pyrococcus horikoshiiPutative uncharacterized protein PH0519	3.40.630.10	236	19	72	2.92	4.01
	2rb7A01	78.15	Peptidase, M20/M25/M40 familyDesulfovibrio desulfuricans subsp. desulfuricans str. G20	3.40.630.10	231	14	74	3.54	4.77
	1vhoA01	77.79	Endoglucanase [EC:3.2.1.4]Thermotoga maritimaStarch and sucrose metabolismEndoglucanase	3.40.630.10	237	15	72	2.90	4.00
	3kasA01	76.72	Integral to plasma membraneHematopoietic cell lineageExtracellular regionCoated pitEndocytosis	3.40.630.10	308	6	74	3.27	4.42

>pdb|1fnoA01
DKLLERFLHYVSLDTQSKSGVRQVPSTEGQWKLLRLLKQQLEEGLVNITLSEKGTLATLPANVEGDIPAIGFISHVDTSP
DFSGKNVNPQIVENYRGGDIALGIGDEVLSPVFPVLHQLLGQTLITTDGKTLLGADDKAGVAEITALAVLKGNPIPHGDI
KVAFTPDEEVGKGAKHFDVEAFGAQWAYTVDGGGVGELEFENFNYNREKVVEHPHILDIAQQARDCHITPEKPIRGGTDG
AQLSFGLPCPNLFTGGYNYHGKHEFVTLEGEKAVQVIVRIAELTAK    

>pdb|1fnoA01
XDKLLERFLHYVSLDTQSKSGVRQVPSTEGQWKLLRLLKQQLEEXGLVNITLSEKGTLXATLPANVEGDIPAIGFISHVD
TSPDFSGKNVNPQIVENYRGGDIALGIGDEVLSPVXFPVLHQLLGQTLITTDGKTLLGADDKAGVAEIXTALAVLKGNPI
PHGDIKVAFTPDEEVGKGAKHFDVEAFGAQWAYTVDGGGVGELEFENFNYNXREKVVEHPHILDIAQQAXRDCHITPEXK
PIRGGTDGAQLSFXGLPCPNLFTGGYNYHGKHEFVTLEGXEKAVQVIVRIAELTAK