Set cath from cathlist by auto on 05 Mar 2006 19:27
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1fg7A01 | 54 | 258 |
| 1fg7A02 | 5 | 43 |
| 1fg7A02 | 261 | 350 |
There are 15 matching structural neighberhood comparisons for CATH ID 3.40.640.10.30.1.1.1.1 (SIMAX score < 5)
>pdb|1fg7A01 RYPECQPKAVIENYAQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGYSVSAETIGVECRTVPTLDNWQ LDLQGISDKLDGVKVVYVCSPNNPTGQLINPQDFRTLLELTRGKAIVVADEAYIEFCPQASLAGWLAEYPHLAILRTLSK AFALAGLRCGFTLANEEVINLLKVIAPYPLSTPVADIAAQALS
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"