Set cath from cathlist by auto on 05 Mar 2006 19:03
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1ff9A01 | 2 | 124 |
| 1ff9A01 | 395 | 442 |
| 1ff9A02 | 125 | 249 |
| 1ff9A02 | 350 | 394 |
| 1ff9A02 | 443 | 450 |
| 1ff9A03 | 250 | 349 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1ff9A02 LDPGIDHLYAIKTIEEVHAAGGKIKTFLSYCGGLPAPESSDNPLGYKFSWSSRGVLLALRNAASFYKDGKVTNVAGPELM ATAKPYFIYPGFAFVAYPNRDSTPYKERYQIPEADNIVRGTLRYQFEEGERDLVMLQHKFEIENKDGSRETRTSSLCEYG APIGSGGYSAECKEKVVA
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"