Insertion by sillitoe on 06 Mar 2006 15:33
HomCheck 'Assigned T' domains
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1feuA01 | 1 | 91 |
| 1feuA02 | 92 | 185 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1feuA02 SDEPVEMYVPLRFVGTPAGVRAGGVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSLHASDLKLPPGVELAVSPEETI AAVVPPEDVEKLAE
HomCheck 'Assigned T' domains
HomCheck 'Assigned T' domains
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"