Set cath from cathlist by auto on 05 Mar 2006 18:34
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1feuA01 | 1 | 91 |
| 1feuA02 | 92 | 185 |
There are 2 matching structural neighberhood comparisons for CATH ID 2.40.240.10.3.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1v6zA01 | 76.85 | 2.40.240.20 | 65 | 12 | 62 | 2.83 | 4.52 | |
![]() |
1qtqA01 | 76.63 | 2.40.240.10 | 107 | 6 | 58 | 2.47 | 4.20 |
>pdb|1feuA01 MEYRLKAYYREGEKPSALRRAGKLPGLMYNRHLNRKVYVDLVEFDKVFRQASIHHVIVLELPDGQSLPTLVRQVNLDKRR RRPEHVDFFVL
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"