CATH Domain: 1fecA03 XML data for domain: 1fecA03

Molscript image for 1fecA03
1fecA03
PDB coordinates for domain 1fecA03

PDB 1fec, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.390 Enolase-like; domain 1
3.30.390.30 Gene3D
3.30.390.30.3
3.30.390.30.3.1
3.30.390.30.3.1.1
3.30.390.30.3.1.1.1
3.30.390.30.3.1.1.1.1

[top]
Segment boundaries for domain 1fecA03

Chopping figure for domain 1fecA03
DomainStart PDB ResidueStop PDB Residue
1fecA01 1 163
1fecA01 285 359
1fecA02 164 284
1fecA03 360 485

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.30.390.30.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2nvkX03 90.08 Protein homodimerization activityThioredoxin reductase 1, mitochondrialDetermination of adult lifespanThioredoxin-disulfide reductase activityGlutathione-disulfide reductase activity 3.30.390.30 115 30 88 1.49 1.68
1ebdA03 88.01 Dihydrolipoyl dehydrogenaseGeobacillus stearothermophilus 3.30.390.30 115 23 88 2.20 2.50
1xdiA03 86.00 Citrate cycle (TCA cycle)Valine, leucine and isoleucine degradationPyruvate metabolismGlycine, serine and threonine metabolismMetabolic pathways 3.30.390.30 122 15 88 2.53 2.87
1mo9A03 82.76 2-oxopropyl-CoM reductase, carboxylatingXanthobacter autotrophicus Py2 3.30.390.30 153 11 74 2.17 2.91
1nhpA03 82.33 NADH peroxidaseNADH peroxidase [EC:1.11.1.1]Enterococcus faecalis 3.30.390.30 113 11 82 3.17 3.84
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1fecA03
KVACAVFSIPPMGVCGYVEEDAAKKYDQVAVYESSFTPLMHNISGSTYKKFMVRIVTNHADGEVLGVHMLGDSSPEIIQS
VAICLKMGAKISDFYNTIGVHPTSAEELCSMRTPAYFYEKGKRVEK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1fecA03
KVACAVFSIPPMGVCGYVEEDAAKKYDQVAVYESSFTPLMHNISGSTYKKFMVRIVTNHADGEVLGVHMLGDSSPEIIQS
VAICLKMGAKISDFYNTIGVHPTSAEELCSMRTPAYFYEKGKRVEKIDSNL
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:04

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:04

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:32

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"