Set cath from cathlist by auto on 05 Mar 2006 19:34
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1fc6A01 | 78 | 160 |
| 1fc6A01 | 400 | 414 |
| 1fc6A02 | 161 | 252 |
| 1fc6A03 | 253 | 399 |
| 1fc6A03 | 415 | 459 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1fc6A03 NPVTFTTCSNVAAAALPPGAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVLDIRNNGGGLFPAGVNVARLVDR GDLVLIADSQGIRDIYSADGNSIDSATPLVVLVNRGTASASEVLAGALKDSKRGLIAGERTFGKGLTVARYQTPAGVDIN KIGVSPDVQLDPEVLPTDLEGVCRVLGSDAA
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"