Set cath from cathlist by auto on 05 Mar 2006 19:37
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1fc4A01 | 58 | 295 |
| 1fc4A02 | 20 | 53 |
| 1fc4A02 | 296 | 397 |
There are 16 matching structural neighberhood comparisons for CATH ID 3.90.1150.10.19.1.1.1.1 (SIMAX score < 5)
>pdb|1fc4A02 GLFKEERIITSAQQADITVADGSHVINFCANNYLSELRDRLWANARQFREQSAAGFTLAGADHAIIPVLGDAVVAQKFAR ELQKEGIYVTGFFYPVVPKGQARIRTQSAAHTPEQITRAVEAFTRIGKQLGVI
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"