CATH Domain: 1fbvA02 XML data for domain: 1fbvA02

Molscript image for 1fbvA02
1fbvA02
PDB coordinates for domain 1fbvA02

PDB 1fbv, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.40 Herpes Virus-1
3.30.40.10 Zinc/RING finger domain, C3HC4 (zinc finger) Gene3D
3.30.40.10.7
3.30.40.10.7.1
3.30.40.10.7.1.1
3.30.40.10.7.1.1.1
3.30.40.10.7.1.1.1.1

[top]
Segment boundaries for domain 1fbvA02

Chopping figure for domain 1fbvA02
DomainStart PDB ResidueStop PDB Residue
1fbvA01 176 264
1fbvA02 359 434
1fbvA03 265 350
1fbvA04 47 175

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.40.10.7.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1g25A00 76.72 CDK-activating kinase assembly factor MAT1Positive regulation of transcription from RNA polymerase II promoterZinc ion bindingProtein N-terminus bindingNucleotide excision repair 3.30.40.10 65 20 75 2.87 3.83
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1fbvA02
DHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVDPF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1fbvA02
DHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVDPF
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:58

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:58

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:32

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"