Set cath from cathlist by auto on 05 Mar 2006 18:24
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
There are 30 matching structural neighberhood comparisons for CATH ID 2.30.29.30.17.1.1.1.1 (SIMAX score < 5)
>pdb|1faoA00 PSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCA KTGVEADEWIKILRWKLSQI
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"