Set cath from cathlist by auto on 05 Mar 2006 19:33
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1f8fA01 | 4 | 177 |
| 1f8fA01 | 315 | 371 |
| 1f8fA02 | 178 | 314 |
There are 7 matching structural neighberhood comparisons for CATH ID 3.90.180.10.10.1.1.1.1 (SIMAX score < 5)
>pdb|1f8fA01 LKDIIAAVTPCKGADFELQALKIRQPQGDEVLVKVVATGMCHTDLIVRDQKYPVPLPAVLGHEGSGIIEAIGPNVTELQV GDHVVLSYGYCGKCTQCNTGNPAYCSEFFGRNFSGADSEGNHALCVNDHFFAQSSFATYALSRENNTVKVTKDVPIELLG PLGCGIQTVEGSGSPKKFIPELVRLYQQGKFPFDQLVKFYAFDEINQAAIDSRKGITLKPIIKIA
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"