CATH Domain: 1f7uA02 XML data for domain: 1f7uA02

Molscript image for 1f7uA02
1f7uA02
PDB coordinates for domain 1f7uA02

PDB 1f7u, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.730 Isoleucyl-tRNA Synthetase; Domain 1
1.10.730.10 Isoleucyl-tRNA Synthetase; Domain 1 Gene3D
1.10.730.10.6
1.10.730.10.6.1
1.10.730.10.6.1.1
1.10.730.10.6.1.1.1
1.10.730.10.6.1.1.1.1

[top]
Segment boundaries for domain 1f7uA02

Chopping figure for domain 1f7uA02
DomainStart PDB ResidueStop PDB Residue
1f7uA01 136 482
1f7uA02 483 607
1f7uA03 2 135

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.10.730.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1rqgA04 81.18 Aminoacyl-tRNA biosynthesisSelenoamino acid metabolismPyrococcus abyssiMethionyl-tRNA synthetaseMethionyl-tRNA synthetase [EC:6.1.1.10] 1.10.730.10 151 5 76 2.79 3.63
1qu3A04 79.91 Aminoacyl-tRNA biosynthesisIsoleucyl-tRNA synthetase [EC:6.1.1.5]Isoleucyl-tRNA synthetaseStaphylococcus aureusValine, leucine and isoleucine biosynthesis 1.10.730.10 150 6 80 3.03 3.79
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1f7uA02
GDTGPYLQYAHSRLRSVERNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDVLRNAIKTHEPTTVVTYLFKLTHQVS
SCYDVLWVAGQTEELATARLALYGAARQVLYNGMRLLGLTPVERM
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1f7uA02
GDTGPYLQYAHSRLRSVERNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDVLRNAIKTHEPTTVVTYLFKLTHQVS
SCYDVLWVAGQTEELATARLALYGAARQVLYNGMRLLGLTPVERM
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:15

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:15

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:31

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"